|
Plant Physiol, January 2002, Vol. 128, pp. 300-313
Molecular Cloning, Functional Characterization, and Subcellular
Localization of Soybean Nodule Dihydrolipoamide
Reductase1,2
Jose F.
Moran,*
Zhaohui
Sun,
Gautam
Sarath,
Raúl
Arredondo-Peter,
Euan K.
James,
Manuel
Becana, and
Robert V.
Klucas
Departamento de Nutrición Vegetal, Estación
Experimental de Aula Dei, Consejo Superior de Investigaciones
Científicas, 50080 Zaragoza, Spain (J.F.M., M.B.); Department
of Biochemistry, University of Nebraska-Lincoln, Lincoln, Nebraska
68588 (Z.S., G.S., R.V.K.); Laboratorio de Biofísica y
Biología Molecular, Facultad de Ciencias, Universidad
Autónoma del Estado de Morelos, Avenida Universidad 1001, Colonia
Chamilpa, 62210 Cuernavaca, Morelos, Mexico (R.A.-P.); and Centre for
High Resolution Imaging and Processing, MSI/WTB Complex, School of Life
Sciences, University of Dundee, Dundee DD1 5EH, United Kingdom (E.K.J.)
 |
ABSTRACT |
Nodule ferric leghemoglobin reductase (FLbR) and leaf
dihydrolipoamide reductase (DLDH) belong to the same family of pyridine nucleotide-disulfide oxidoreductases. We report here the cloning, expression, and characterization of a second protein with FLbR activity, FLbR-2, from soybean (Glycine max) nodules.
The cDNA is 1,779 bp in length and codes for a precursor protein
comprising a 30-residue mitochondrial transit peptide and a 470-residue
mature protein of 50 kD. The derived protein has considerable homology with soybean nodule FLbR-1 (93% identity) and pea (Pisum
sativum) leaf mitochondria DLDH (89% identity). The cDNA
encoding the mature protein was overexpressed in Escherichia
coli. The recombinant enzyme showed Km
and kcat values for ferric leghemoglobin
that were very similar to those of DLDH. The transcripts of FLbR-2 were
more abundant in stems and roots than in nodules and leaves. Immunoblots of nodule fractions revealed that an antibody raised against pea leaf DLDH cross-reacted with recombinant FLbR-2, native FLbR-2 of soybean nodule mitochondria, DLDH from bacteroids, and an
unknown protein of approximately 70 kD localized in the nodule cytosol.
Immunogold labeling was also observed in the mitochondria, cytosol, and
bacteroids of soybean nodules. The similar biochemical, kinetic, and
immunological properties, as well as the high amino acid sequence
identity and mitochondrial localization, draw us to conclude that
FLbR-2 is soybean DLDH.
 |
INTRODUCTION |
Legume N2
fixation requires the presence of abundant functional leghemoglobin
(Lb) in the cytosol of nodule infected cells. The main function of this
hemoprotein is to deliver O2 to the bacteroids at
a concentration compatible with nitrogenase activity and bacteroid
respiration (for review, see Appleby, 1984 ). To carry
O2, Lb must be present in the ferrous form and,
indeed, young, actively N2-fixing nodules contain
only ferrous or oxyferrous Lb (Appleby, 1984 ; King et al., 1988 ; Monroe
et al., 1989 ). However, the chemical nature of Lb itself and various
conditions existing in nodules are conducive for Lb oxidation (Becana
and Klucas, 1992 ; Lee et al., 1995 ). Using diffuse reflectance and
direct transmission spectroscopy, Lee and Klucas (1984) showed that
ferric Lb generated in soybean (Glycine max) nodule slices
by treatment with hydroxylamine is rapidly reduced to ferrous Lb and
that ferric Lb is present in senescent sweet clover (Melilotus
officinalis) and soybean nodules (Lee et al., 1995 ). These
observations indicate that mechanisms exist in the nodules to maintain
Lb in the functional, reduced state.
Saari and Klucas (1984) isolated from soybean nodules a protein capable
of catalyzing the NADH-dependent reduction of ferric to ferrous Lb.
This protein with ferric Lb reductase activity (FLbR), designated
FLbR-1, was characterized and shown to be a homodimer of 110 kD with
FAD and a redox-active disulfide group per subunit (Ji et al., 1991 ).
FLbR-1 exhibits high affinity for ferric Lb
(Km = 9 µM) and
NADH (Km = 50 µM),
which is consistent with its proposed role in maintaining Lb in its
functional state (Saari and Klucas, 1984 ; Becana and Klucas, 1990 ; Ji
et al., 1991 ). In soybean nodules, two additional proteins with FLbR
activity are present (Ji et al., 1991 ), and at least two gene copies
have been detected (Ji et al., 1994a ). A cDNA encoding FLbR-1 was
isolated, and the deduced protein sequence showed high homology with
dihydrolipoamide dehydrogenase (DLDH) and, to a lesser extent, with
glutathione reductase, mercuric reductase, and trypanothione reductase
from various organisms (Ji et al., 1994a ; Pullikuth and Gill, 1997 ). All of these enzymes belong to the NAD:disulfide oxidoreductase family
and are homodimers containing FAD and a pair of redox-active Cys
residues involved in the electron transfer from NAD(P)H and flavin to
the substrates (Williams, 1991 ).
In pea (Pisum sativum) leaf mitochondria, the same DLDH
isozyme is shared by the pyruvate dehydrogenase complex (E3 component) and the Gly decarboxylase complex (L protein; Bourguignon et al., 1996 ). Both enzymatic complexes catalyze oxidative decarboxylations in
plant mitochondria, which are essential for the functioning of the
tricarboxylic acid and the photorespiratory cycles, respectively (Rawsthorne et al., 1995 ). Pea chloroplasts also contain a DLDH isozyme, but this is distinctly different from its mitochondrial counterpart (Conner et al., 1996 ).
The high homology between FLbR and DLDH (Pullikuth and Gill, 1997 ), the
physiological relevance that FLbR may have in legume N2 fixation (Saari and Klucas, 1984 ), the
critical role of DLDH in energy metabolism (Rawsthorne et al., 1995 ),
and the observation that both FLbR and DLDH are present in plant
tissues as various isozymes (Ji et al., 1991 ; Conner et al., 1996 )
prompted us to study other proteins with FLbR activity present in
nodules and to establish their relationships with DLDHs. In this work,
we have cloned and characterized a novel gene encoding a second protein exhibiting FLbR activity, designated FLbR-2, from soybean nodules. The
protein was overexpressed in Escherichia coli, its
biochemical properties were compared with those of FLbR-1 and DLDH, and
its subcellular localization was determined by subcellular
fractionation and immunogold labeling.
 |
RESULTS |
Isolation, Cloning, and Sequencing of FLbR-2 cDNA
We have isolated a cDNA (GenBank accession no. AF074940) encoding
a novel protein with FLbR activity, FLbR-2, from a soybean nodule
library (Ji et al., 1994a ). Primers designed to conserved sequences of
FLbR-1 were used to clone four independent PCR products. The
full-length sequence of FLbR-2 was highly homologous at the nucleotide
and amino acid levels with soybean nodule FLbR-1 (>93% identity; Ji
et al., 1994a ) and pea leaf DLDH (>86% identity; Bourguignon et al.,
1996 ). The 5'- and 3'-untranslated regions (UTRs) were PCR amplified
using internal primers for the FLbR-2 cDNA in combination with
-primers (Arredondo-Peter et al., 1997 ). The cDNA was 1,779 bp long
and contained an open reading frame of 1,503 bp, which codes for a
500-amino acid protein. Based on the N-terminal of native FLbR-1
(nFLbR-1) of soybean nodules (Ji et al., 1991 ), the precursor protein
of nFLbR-2 was predicted to include a 30-residue signal
peptide and a 470-residue mature polypeptide (Fig.
1), with an estimated molecular mass of
49,618 D. The existence of a signal peptide was further demonstrated in
this work by automated N-terminal Edman degradation of nFLbR-1 and
nFLbR-2, which confirmed that the signal peptide is processed, consistent with previous results of Ji et al. (1991) . Both FLbR-1 and
FLbR-2 appear to possess an identical leader sequence (Fig. 1).

View larger version (81K):
[in this window]
[in a new window]
|
Figure 1.
Comparison of deduced amino acid sequences of
FLbRs and selected DLDHs from plants and other organisms. Residues
identical in at least six of eight residues are indicated in white
lettering on a black background. Twenty-eight N-terminal and nine
C-terminal amino acids were sequenced automatically and are indicated
with a continuous line. The cleavage site of the precursor proteins of
FLbR-1 and FLbR-2 is indicated with an arrow. The conserved FAD- and
NADH-binding domains are marked with a discontinuous line, and the
presumptive active site Cys residues are marked with asterisks.
Sequence alignment was performed using the PileUp program. GenBank
accession numbers are as follows: soybean FLbR-1, S70187; soybean
FLbR-2, AF074940; cowpea (Vigna unguiculata) FLbR,
AF181096; pea DLDH, X63464; Arabidopsis E3, AF228640; human DLDH,
P09622; yeast (Saccharomyces cerevisiae) DLDH,
P09624; E. coli DLDH, P00391.
|
|
The transit peptide of FLbR-2 and FLbR-1 closely resembles those of
other proteins that are targeted to the mitochondria (von Heijne et
al., 1989 ). The peptide is enriched in Arg (17%), Ser (13%), Leu
(13%), and Ala (13%) and lacks acidic residues (Fig. 1). The cleavage
site fits into the RGF A motif, which can be clearly assigned to the
RXY S/A or "R-3" mitochondrial motif described by Gavel and von
Heijne (1990) , assuming that the two aromatic residues, Tyr and Phe,
are functionally interchangeable. Indeed, prediction programs of
subcellular localization, including Mitoprot II, PSORT, and Target-P,
indicated that both nFLbR-1 and nFLbR-2 are mitochondrial enzymes.
It is interesting that a recently reported protein homolog of nFLbR-2
from cowpea nodules (GenBank accession no. AF181096; Luan et al., 2000 )
has an identical cleavage site motif and therefore also a putative
30-amino acid signal peptide for mitochondrial targeting (Fig.
1).
Expression and Overproduction of rFLbR-2
A 1,483-bp fragment coding for the mature part of the protein was
cloned into the NdeI and XhoI sites of the
expression vector pET-28a(+) and used to transform E. coli
BL21(DE3). Analysis by SDS-PAGE of the cell extracts showed the
overexpression of a protein of approximately 50 kD after induction of
the cells with
isopropyl- -D-thiogalactopyranoside (IPTG) for
a period of 1 to 6 h. Longer incubation times in the presence of
IPTG led to the degradation of the recombinant protein, producing a
fragment of approximately 16 kD, probably as a result of proteolytic
activity (data not shown). The recombinant FLbR-2 (rFLbR-2) separated
by SDS-PAGE and stained with Coomassie blue was, apparently, the major
induced protein.
Enzyme Purification
rFLbR-2 was purified to near homogeneity as judged by SDS and
isoelectric focusing (IEF) gels. The purification method involved affinity chromatography using a Ni-Probond column, which selectively bound the poly-His tag-fused FLbR-2, followed by anion-exchange chromatography (Table I). The
metal-chelate affinity purification step was critical to separate
rFLbR-2 from E. coli DLDH. The enzyme was
purified 42-fold in terms of ferric Lb-reducing activity and 323-fold
in terms of lipoamide reductase activity. The 6×-His tag was removed
with a biotinylated thrombin system, as confirmed by N-terminal
sequencing and SDS-gel analysis. The specific activities of rFLbR-2
were 958 and 83,055 units mg 1 for FLbR and DLDH
activities, respectively (Table I). The recombinant enzyme
cross-reacted with antibodies raised against nFLbR (probably a mixture
of three isozymes; see also Fig. 3B) from soybean nodules (Ji et al.,
1994b ) and against DLDH from pea leaf mitochondria (see below).
Protein Sequence and Mass Spectrometry (MS) Analysis
N-Terminal sequencing of rFLbR-2 revealed that the sequence of the
32 first amino acids is GSHMASGSDENDVVVIGGGPGGYVAAIKAAQL, which
comprises four amino acid residues of the pET-28 vector downstream of
the excision site for thrombin plus the 28 amino acid residues of the
deduced protein sequence. To unequivocally demonstrate the existence of
the predicted C terminus in the FLbR-2 sequence, SDS-purified rFLbR-2
was subjected to digestion with cyanogen bromide. The HPLC-resolved
peptides were analyzed by electrospray MS and/or N-terminal sequencing
(Fig. 2). Peptide 6 was proved to be the
rFLbR-2 specific N-terminal fragment by electrospray MS molecular mass
determination and N-terminal sequencing. Peptide 21 corresponded to
residues 449 to 491 as determined by N-terminal sequencing. Using this
technique, we could determine the existence of peptide 6 in the
IEF-separated upper isozyme of the nFLbR. This peptide had an identical
mass of 1,057 D when analyzed by electrospray MS (Fig. 2).

View larger version (33K):
[in this window]
[in a new window]
|
Figure 2.
HPLC profile of the cyanogen bromide (CNBr)
digestion of rFLbR-2. Peak 6 was further analyzed by N-terminal
sequencing and electrospray MS (inset). Dotted lines, Blank; solid
line, CNBr (3 mg).
|
|
Electrospray MS analysis showed that rFLbR-2 has a molecular mass of
50,027 D, which is virtually identical to the predicted mass, 50,030 D. The molecular mass determined by MS corresponded to only the
polypeptide, because the flavin was released during the analysis,
producing a peak at 786.1 D (data not shown). Collectively, these data
indicated that the recombinant protein was correctly synthesized in
E. coli, that FAD is the flavin coenzyme of FLbR-2, and that
FAD is not covalently bound to the protein.
Biochemical Properties of rFLbR-2
Native PAGE suggested that FLbR-2 is a homodimer because the
recombinant protein showed exactly the same mobility as the dimeric soybean nFLbR (Fig. 3A). rFLbR-2 and
nFLbR were isoelectrofocused in an effective pI range of 6.5 to 4.0 and
compared to pI standards (Fig. 3B). rFLbR-2 matched the upper isozyme
of the three reported by Ji et al. (1994b) , with an estimated pI of
5.8. The other nFLbRs isozymes had pI values of 5.7 and 5.6, respectively. The slight difference (0.1 unit) from the reported pI
values of Ji et al. (1991) is probably due to a narrower range of
ampholytes used in this study.

View larger version (30K):
[in this window]
[in a new window]
|
Figure 3.
A, Native PAGE of soybean nFLbR (lane 1), rFLbR-2
(lane 2), and porcine heart DLDH (lane 3). Samples (approximately 6 µg of protein) were electrophoresed on a 7.5% (w/v)
polyacrylamide gel and stained with Coomassie Brilliant Blue. B, IEF of
purified nFLbR from soybean nodules (lane 2) and rFLbR-2 (lane 3).
Samples (approximately 5 µg of protein) were electrophoresed on a
7.5% (w/v) polyacrylamide gel and stained with Coomassie Brilliant
Blue/crocein scarlet. Values of pI are indicated for standards (lane 1)
and FLbRs. The following IEF standards (Bio-Rad, Hercules, CA) were
used: phycocianin (4.65), -lactoglobulin B (5.10), bovine carbonic
anhydrase (6.00), and human carbonic anhydrase (6.50).
|
|
UV-visible spectra of rFLbR-2 revealed high similarities to those of
pig and yeast DLDH and oxidized soybean FLbR-1 (Ji et al., 1994b ). The
rFLbR-2 showed a UV absorption peak at 278 nm and a visible absorption
peak at 460 nm, with two shoulders at 435 and 485 nm, consistent with
the presence of FAD as a prosthetic group.
Because FLbR-2 is able to use both ferric Lb and lipoamide as
substrates, a comparison of the kinetic constants for the two reactions
was considered essential to gain information concerning the putative
function(s) of the isozyme. The calculated
Km values of rFLbR-2 were 29 µM for ferric Lb, 58 µM
for NADH, and 3.38 mM for lipoamide (Table
II). Consequently, the
kcat to Km
ratios for lipoamide and Lb were 116 and 55 mM
s 1, respectively.
The latter two values are very similar to those of DLDHs from yeast,
bovine, and pig mitochondria, although the kcat/Km ratio
for NADH was considerably greater for rFLbR-2. Also, the
Km values (250-500
µM) for lipoamide of yeast, bovine, and pea
leaf DLDHs were significantly lower than the corresponding value of
rFLbR-2 (Kim, 1996 ; Neuburger et al., 2000 ). On the other hand, rFLbR-1
showed significantly higher affinity (5-fold),
kcat (4-fold), and
kcat/Km ratio
(18-fold) for ferric Lb than rFLbR-2 and also differs in kinetic
behavior from yeast and bovine DLDHs (Table II).
Expression and Localization of FLbR-2 in Soybean
Reverse transcription (RT)-PCR analysis was used to study
tissue-specific expression of flbr-2 in soybean (Fig.
4A). The transcript is more abundant in
the stems and roots than in the leaves and nodules. As expected, Lb
transcript was detectable only in nodules, whereas that of
constitutively expressed Gln synthetase was found in all four tissues
examined, especially in roots and nodules. A similar analysis was
performed to determine the effect of nodule age on flbr-2
expression (Fig. 4B). The flbr-2 transcript was more
abundant in mature nodules (4-6 weeks old) with a slight decrease in
senescent nodules (10 weeks old). A similar pattern was followed by the
Lb mRNA, although in this case there was no apparent decline in
senescent nodules. As expected, there were no major changes in the
level of the Gln synthetase transcript.

View larger version (80K):
[in this window]
[in a new window]
|
Figure 4.
A, Expression of flbr-2 in different
soybean tissues (L, leaves; S, stems; R, roots; N, nodules). B, Effect
of nodule age (in weeks) on the expression of flbr-2. Gln
synthetase (GS) and Lb were used as markers of metabolic activity in
plant tissues and nodules, respectively. Ubiquitin (Ubi) was used as an
internal control of the RT-PCR analysis.
|
|
Immunoblots of whole extracts and various fractions from soybean
nodules revealed that an antibody to pea leaf mitochondria DLDH
recognized rFLbR-2 (Fig. 5, lane 1), as
well as proteins of mitochondria and bacteroids (Fig. 5, lanes 4 and
5). The major (or single, in some cases) immunoreactive band was at
approximately 50 kD and is therefore consistent with the expected
molecular mass of FLbR-2, as well as with the expected mitochondrial
localization of FLbR-2 and DLDH. Immunoblots also showed an
immunoreactive band of approximately 70 kD in the soybean nodule
cytosol (Fig. 5, lane 3). Extracts from soybean leaves or from pea
nodules and leaves were also analyzed to verify results. Immunoreactive
bands of 50 kD were observed in soybean and pea leaves and in pea
nodules. The 70-kD cytosolic protein of soybean nodules was not found
in soybean and pea leaves or in pea nodules (Fig. 5, lanes
6-8).

View larger version (72K):
[in this window]
[in a new window]
|
Figure 5.
Immunoblot analysis of FLbR-2 in soybean and pea
nodules and leaves using anti-pea DLDH antibody. Lanes: 1, Pure
rFLbR-2; 2, soybean nodule extract; 3, soybean nodule cytosol; 4, soybean nodule mitochondria; 5, soybean nodule bacteroids; 6, soybean
leaf extract; 7, pea nodule extract; 8, pea leaf extract. Estimates of
molecular mass of the relevant proteins (shown in kilodaltons) were
obtained using prestained SDS Mr markers
(Bio-Rad). Protein loaded was 10 µg for all lanes, except for lane 1 (50 ng) and lane 5 (20 µg).
|
|
The subcellular localization of FLbR-2 in soybean and pea nodules was
also investigated by immunogold labeling using the same antibody (Fig.
6). The main areas examined were
three-way cell junctions within the infected zone, because these cells
are known to contain a high concentration of mitochondria adjacent to
the intercellular space (Millar et al., 1995 ). There was significant labeling of mitochondria in both infected and uninfected cells (Fig. 6,
A and C). However, the most intense labeling was seen on some of the
bacteroids (Fig. 6, A and B), particularly on the electron-dense
nuclear material (Fig. 6B). Labeling was also observed in the cytosol
of infected cells, which, although sparse (Fig. 6, A and B), was
significantly greater than that obtained with non-immune serum (Table
III). Some minor labeling was only
occasionally observed in peroxisomes of uninfected cells (Fig. 6C). The
pattern of immunolabeling was similar in pea nodule sections with the exception that the gold labeling in the cytosol was not significantly above the background (non-immune serum; Table III).

View larger version (136K):
[in this window]
[in a new window]
|
Figure 6.
Immunogold localization of FLbR-2 in soybean
nodules. Sections were probed with an antibody raised against pea leaf
DLDH (A-C) or non-immune serum (D), followed by secondary antibodies
conjugated to 15-nm gold particles. A, Three-way junction of infected
cells in the active, N2-fixing zone of a soybean
nodule. Gold particles can be seen on mitochondria (m) and bacteroids
(b), as well as in the cytosol (small arrows). B, Labeling of
electron-dense nuclear material (large arrows) within the bacteroids
(b), with scant labeling in the cytosol (small arrow). C, Uninfected
cell with labeling on mitochondria (m) and peroxisomes (px). Note the
adjacent infected cell (*), with labeling in mitochondria. D, Serial
section to A and C that was incubated in non-immune serum. No gold
particles are visible on mitochondria (m) or in the cytosol, but one
can be seen in a bacteroid (b; arrow). s, Intercellular space.
Bars = 500 nm.
|
|
View this table:
[in this window]
[in a new window]
|
Table III.
Number of gold particles on infected cell
components from soybean and pea nodules
Means ± SE were taken from 10 micrographs, each with
an area of 25 µm2. Values significantly different from
the corresponding non-immune serum according to the Student's
t test are marked with * (P < 0.05) or ** (P < 0.01).
|
|
Sections of soybean nodules that had been immunogold labeled with
anti-DLDH antibody pre-absorbed with 40 µg
mL 1 of rFLbR-2 protein (Fig.
7A) showed similar labeling intensities to sections directly labeled with the antibody (Fig. 6, A-C). However,
sections that had been labeled with the antibody pre-absorbed with 400 µg mL 1 (data not shown) or 1,600 µg
mL 1 (Fig. 7B) had no labeling in mitochondria
and very scant labeling over the cytosol and bacteroids. These results
confirm that the FLbR-2 protein located in the mitochondria is
immunoprecipitated by the anti-DLDH antibody and that there are
additional proteins in the cytosol and bacteroids that are also
recognized by the antibody, albeit with lower specificity.

View larger version (118K):
[in this window]
[in a new window]
|
Figure 7.
Immunogold localization of FLbR-2 in soybean
nodules. A, Section probed with anti-pea DLDH antibody pre-absorbed
with 40 µg mL 1 rFLbR-2 protein. Arrows show
labeling of mitochondria (m), bacteroids (b), and cytosol. B, Section
probed with anti-pea DLDH antibody pre-absorbed with 1,600 µg
mL 1 rFLbR-2 protein. No gold particles are
visible on mitochondria (m), but a few can still be seen within
bacteroids and in the cytosol (arrows). s, Intercellular space.
Bars = 500 nm.
|
|
 |
DISCUSSION |
A major goal of this work was to isolate proteins with FLbR
activity from soybean nodules. The sequence of the FLbR-1 cDNA was used
to design primers and amplify by PCR other FLbR-encoding cDNA sequences
from a soybean nodule library. This strategy proved to
be successful and enabled us to isolate a cDNA clone encoding a
protein, FLbR-2, homologous to, but clearly different from, FLbR-1.
Southern analysis of genomic DNA using soybean cDNA for FLbR-1 as a
probe indicated that at least two copies of the flbr gene
are present in the soybean genome (Ji et al., 1994a ). One of these
copies should be logically attributed to flbr-2, but additional flbr genes may be still present in soybean.
Because the FLbR-1 and FLbR-2 cDNAs were obtained from an identical
soybean library, both genes are expressed in the same growth stage of the plant and the differences at the nucleotide level cannot be accounted for by allelic variations between cultivars. Sequence analyses revealed high homology of FLbR-2 with soybean FLbR-1 and pea
DLDH at the nucleotide and amino acid levels. These analyses also
showed that the active disulfide center, FAD-binding domain, and
NADH-binding domain are highly conserved in FLbRs and other oxidoreductases, namely, mercuric acid reductase, trypanothione reductase, and glutathione reductase (Fig. 1). Phylogenetic analyses showed that FLbR-1 clustered with the DLDH group, whereas the other
oxidoreductases form a separate group (Pullikuth and Gill, 1997 ). As
expected, soybean nodule FLbR-2 (this work) and its cowpea nodule
homolog (Luan et al., 2000 ) are also closer to the DLDH proteins than
to the other enzymes of the oxidoreductase family (data not shown).
There were at least two major differences between FLbR-1 and FLbR-2.
The first is the existence of 23 extra amino acids at the C terminus of
FLbR-1. The C terminus of FLbR-2 shares high homology with the family
of eukaryotic DLDHs as opposed to soybean FLbR-1 (Fig. 1). A comparison
of the 3'-coding region of the FLbR-1 and FLbR-2 cDNAs reveals that one
base (g1,512) is deleted in the latter, resulting
in a frameshift and in the consequent formation of an early stop codon.
This change in the FLbR-2 cDNA sequence was detected in several
independent clones sequenced in both directions in this region of the
cDNA. The function of the 23 additional residues remains unknown, but
they could conceivably influence substrate specificities and/or
subcellular localization. The second difference is that FLbR-1 and
FLbR-2 differ in the gene expression pattern within the soybean plant (compare figure 6 in Ji et al., 1994a with Fig. 4A in this paper). The
transcripts of flbr-1 are particularly abundant in nodules and leaves, whereas the transcripts of flbr-2 are more
abundant in the shoot and root. Although this expression pattern does
not preclude a role of the enzyme as FLbR, it indicates that its main function is not related to N2 fixation. In fact,
it is consistent with the conclusion that FLbR-2 is indeed the soybean DLDH.
Immunoblot analysis and immunogold labeling using an antibody to pea
leaf DLDH (Figs. 5 and 6) allowed a number of important conclusions to
be drawn. (a) The antibody recognizes rFLbR-2 purified from E. coli as well as nFLbR-2 from soybean and pea. In all cases, major
immunoreactive bands were detected at approximately 50 kD. A second
immunoreactive band at approximately 104 kD may correspond to the
homodimer, which is the native state of FLbRs (Ji et al., 1991 ; Luan et
al., 2000 ), assuming that this protein was particularly resistant to
denaturation. (b) FLbR-2 is indeed localized in mitochondria, confirming that, as predicted, the enzyme is synthesized in the nodules
as a preprotein bearing a mitochondrial transit peptide. (c) An
immunoreactive protein is also present in the bacteroids, as expected
for the cross-reaction between plant and bacterial DLDHs. (d)
Immunoreactive bands at 50 kD are also present in soybean and pea
leaves, as expected for mitochondrial DLDHs and in agreement with
flbr-2 expression in leaf tissue (Fig. 4). (e) There is a 70-kD immunoreactive protein as well as gold labeling in the cytosol of
soybean nodules but not of pea nodules. This provides correlative, but
strong, evidence that the labeling observed in the soybean nodule
cytosol is attributable to the 70-kD protein rather than to FLbR-2 or DLDH.
The location of nFLbR-2 in nodule mitochondria is at odds with the
capacity of this enzyme to reduce ferric Lb, which is a cytosolic
protein. We are forced to conclude that FLbR-2 is not involved in Lb
reduction in vivo. However, we cannot exclude the possibility that
other FLbR isozymes or DLDH-like proteins play such a role. Thus, the
finding of a protein immunoreactive to DLDH antibody present in the
soybean nodule cytosol deserves further investigation. The
similar biochemical, kinetic, and immunological properties of soybean
nodule FLbR-2 and pea leaf DLDH, their very high amino acid sequence
identity, and their colocalization in mitochondria all draw us to the
conclusion that FLbR-2 is soybean nodule DLDH. There is no previous
information about any DLDH of legume nodules, despite its critical role
in energy metabolism. In pea leaves, there are at least two DLDHs, one
isozyme located in the mitochondria, which is shared by the pyruvate
dehydrogenase and Gly decarboxylase complexes (Bourguignon et al.,
1996 ), and another isozyme located in the chloroplasts (Conner et al.,
1996 ). In the nodules, the role of DLDH is probably related to its
participation in the pyruvate dehydrogenase complex, which catalyzes
the key regulatory step of carbohydrate metabolism (the oxidative
decarboxylation of pyruvate) in the mitochondria (Bourguignon et al.,
1996 ; Conner et al., 1996 ). These organelles are very abundant and
active in both the nodule parenchyma (inner cortex) and at the
periphery of infected cells (Millar et al., 1995 ; Dalton et al., 1998 ). Therefore, we can predict that nodule FLbR-2 (or DLDH) will be essential to maintain respiratory activity in nodules and, hence, optimal N2 fixation. However, as indicated by the
immunolocalization data presented in this work, it will be important to
identify other DLDH isozymes or closely related DLDH proteins in nodule compartments other than the mitochondria, especially in the cytosol.
 |
MATERIALS AND METHODS |
Amplification and Isolation of FLbR-2 cDNA
Two oligonucleotide primers (forward:
5'-CATATGGCGTCCGGATCTGAC-3'; reverse:
5'-AAGCTTCATCTCCAAGTCATTGTAA-3') were designed to
amplify a 1.5-kb fragment from a gt11 cDNA library from soybean (Glycine max) nodules (Ji et al., 1994a ). The
oligonucleotides contained an NdeI site at the ATG
starting codon and an HindIII site for the antisense
primer, respectively (underlined). The nodule library was used as the
template for PCR amplification. PCR components and concentrations were
as follows: 0.5 µM for each sense and antisense primer,
200 µM for each deoxyribonucleoside triphosphate
(dNTP), 1.5 mM MgCl2, and 2.5 units of
Taq DNA polymerase (Life Technologies, Rockville, MD) in
a final volume of 25 µL of the PCR buffer. This consisted of 10 mM Tris-HCl (pH 8.3), 50 mM KCl, 1.5 mM MgCl2, and 0.001% (w/v) gelatin. Before
amplification, tubes were incubated at 95°C for 3 min to ensure that
the template DNA was completely denatured. Amplification was carried
out for 40 cycles at 55°C/1 min for annealing, 72°C/1.5 min for
extension, and 95°C/1 min for denaturation. An additional annealing
and extension step were performed at 55°C/1 min and 72°C/5 min,
respectively. The total volume of the PCR samples was electrophoresed
in a 1.0% (w/v) agarose gel. The PCR products were isolated from the
melted agarose using the Geneclean kit (Bio 101, Vista, CA) and
resuspended in 10 µL of sterile water.
Cloning and Sequencing of the cDNA
An aliquot (4 µL) of the resuspended DNA was used to clone
each PCR product into the linearized vector pCR2.1 (Invitrogen, Carlsbad, CA) following the manufacturer's instructions. Several independent clones were sequenced in both directions by the dideoxy method (Sanger et al., 1977 ) at the DNA Sequencing Facility of the
University of Nebraska-Lincoln. Database searches were performed with
the BLAST program (Altschul et al., 1997 ). Sequence alignments and
homology analyses were performed using the PileUp and Bestfit programs,
respectively, of the Genetics Computer Group (Madison, WI). Signal
peptide analyses and predictions of subcellular localization were
performed using the programs MitoProtII (Claros, 1995 ), PSORT (Nakai
and Kanehisa, 1992 ), and TransitP (Center for Biological Sequence
Analysis, Department of Biotechnology, Technical University of Denmark, Copenhagen).
An flbr-2 internal reverse primer
(5'-CGGCCCCATACTGAGCC-3') and a -forward primer were used to
obtain by PCR the 5'-UTR and the transit peptide sequence of the FLbR-2
cDNA. To obtain the 3'-UTR, combinations of flbr-2
internal forward oligonucleotide (5'-TAGTCATTGGGGCAGGCTAC-3') with
-forward and -reverse primers were used (Arredondo-Peter et al.,
1997 ). The PCR components and concentrations were the same as before.
Bands having the expected sizes were cloned into pCR2.1 and sequenced
as described above.
Cloning and Heterologous Expression of the cDNA
The construct pCR2.1::FLbR-2 was digested with
NdeI and XhoI restriction enzymes and
separated on a 1% (w/v) agarose gel. The 1.5-kb fragment was extracted
from the gel using the Geneclean kit and directionally subcloned
in the pET-28a(+) vector (Novagen, Madison, WI) into the
NdeI and XhoI sites. Cells of E.
coli strains XL1 blue (CLONTECH, Palo Alto, CA) and BL21(DE3)
(Invitrogen) were transformed with the resultant construct
pET-28a::FLbR-2. Positive colonies were selected in
Luria-Bertani plates containing kanamycin (100 µg
mL 1).
To determine the optimal incubation time, transformed E.
coli BL21(DE3) cells were grown in small flasks until the
A600 reached 0.5, and IPTG was added at a
final concentration of 1 mM. Aliquots were analyzed every
1 h for a total of 7 h and a final aliquot was taken after
18 h. Cells were dissolved in buffer containing SDS and
electrophoresed in 7.5% (w/v) polyacrylamide denaturing gels.
Purification of Recombinant and Native Proteins
Host cells containing the pET-28a(+):FLbR-2 construct were grown
in a 4-L flask using 1 L of Luria-Bertani broth containing kanamycin (100 µg mL 1). Cultures were vigorously
aerated at 37°C and grown until the A600
reached 0.6; then, 1 mM IPTG was added. Cells were
harvested after 6 h by centrifugation, and the cell paste was
stored at 80°C until used. An aliquot of the cell paste (3 g) was
thawed on ice and resuspended in 50 mL of buffer containing 20 mM potassium phosphate (pH 6.8), 1 mM
phenylmethylsulfonyl fluoride, and 10 µg mL 1 each of
pepstatin, leupeptin, and chymostatin. Lysozyme (2 mg mL 1) was added, and the suspension was incubated at 4°C
with gentle stirring for 15 min and then sonicated with four 1-min
pulses at 70% power (Sonifier 450, Branson Ultrasonics, Danbury, CT). After sonication, DNase (40 units mL 1) and RNase (3 units
mL 1) were added, and the lysed cell suspension was
incubated for another 15 min at 4°C. The suspension was then cleared
by centrifugation at 48,000g for 15 min, and the
resulting supernatant was chromatographed on a Probond Ni-chelating
resin (25 mm i.d. × 50 mm) column (Invitrogen), equilibrated with 20 mM potassium phosphate (pH 7.8). rFLbR-2 was eluted with 20 mM potassium phosphate (pH 6.6) containing 500 mM imidazole and detected at 280 nm. The collected
yellowish fraction was diluted to 0.5 mM EDTA and dialyzed
three times against 50 mM Tris-HCl (pH 7.5) containing 0.5 mM EDTA. This fraction was centrifuged for 10 min at
48,000g, and the supernatant was concentrated using
YM-30 filters (Amicon, Danvers, MA).
The concentrated solution was loaded onto a strong anion-exchange (4.6 × 100 mm; 10-µm particle size) column (Poros HQ-H; Applied
Biosystems, Foster City, CA) equilibrated with 50 mM
Tris-HCl (pH 7.5). Chromatography was performed on a BioCad workstation (Applied Biosystems) with detection at 280 and 400 nm. The column was
washed with 4 column volumes of equilibrating buffer, and then a linear
NaCl gradient (0-500 mM) with 20 column volumes was
applied. rFLbR-2 eluted at approximately 370 mM NaCl.
Collected fractions were pooled and made to 200 mM EDTA.
This solution was salt washed and concentrated on Centricon C-30
devices (Amicon). The fused rFLbR-2 containing a His tag was digested
for 2 h at 20°C with biotinylated thrombin, and the thrombin was
subsequently removed using streptavidin-agarose (Novagen). Protein
purification was monitored by SDS-PAGE (Laemmli, 1970 ). Protein was
determined by a dye-binding assay (Bio-Rad) using bovine serum albumin
as a standard.
Soybean nFLbR-1 and nFLbR-2 were purified from nodules as
reported by Ji et al. (1994b) , except that the ammonium sulfate precipitation step was omitted and an additional anion-exchange chromatography step was performed on the BioCad workstation as described above.
Amino Acid Sequence of rFLbR-2
N-Terminal Sequencing
The partial N-terminal sequences were determined after SDS-PAGE
for rFLbR-2 or after IEF for nFLbR-2 (Jun et al., 1994 ). Proteins were
transferred onto Immobilon-PSQ (Millipore) membranes and
subjected to automated Edman degradation (Procise 494; Applied
Biosystems) using protocols recommended by the manufacturer at the
Protein Core Facility of the University of Nebraska, Lincoln.
Protein Cleavage and Fragment Analysis
Approximately 50 µg of rFLbR separated by SDS-PAGE or nFLbR
separated by IEF was stained with Coomassie blue or with Coomassie blue
plus crocein scarlet, respectively. The destained gel was washed
extensively with water. Gel slices containing the rFLbR band and nFLbR
top band (pI 5.8) were excised and placed in 200 µL of 70% (v/v)
formic acid; then, 3 mg of cyanogen bromide in 70% (v/v) formic acid
was added. Blank pieces of the same gels were used as a control. Gel
pieces were incubated with cyanogen bromide in the dark for 24 h
under an Ar atmosphere. Gel slices were subsequently dried in a vacuum
evaporator, washed with 200 µL of water, and redried. Peptides were
eluted from the gel slices by adding 200 µL of 0.1% (v/v)
trifluoroacetic acid/60% (v/v) acetonitrile, and the samples were
agitated on a rocker at room temperature for 1 h. This step was
repeated twice. Pooled solutions containing peptides were dried as
above and resuspended in 40 µL of 0.05% (v/v) trifluoroacetic
acid/25% (v/v) acetonitrile. This solution was made up to 200 µL
with 0.1% (v/v) trifluoroacetic acid in water. Samples were filtered
through a 0.22-µm filter and analyzed by reversed-phase HPLC (Waters,
Milford, MA) using a C18 (2.1 × 250 mm; 5-µm
particle size) column (Vydac, Hesperia, CA). Peptides were eluted with
a gradient of acetonitrile at 200 µL min 1 and detected
at 210 nm. Selected HPLC peaks were analyzed by N-terminal sequencing
as described above and/or by electrospray MS at the Center for Mass
Spectrometry, University of Nebraska, Lincoln.
Characterization of rFLbR-2
Purified rFLbR-2 was electrophoresed in a 7.5% (w/v)
polyacrylamide SDS gel, blotted onto a nitrocellulose membrane, and
probed with anti-soybean nFLbR antibodies at a dilution of 1:1,000
(Ji et al., 1991 ) as described by Sarath and Wagner (1989) . Pig DLDH was included as a control. Native and SDS-PAGE (7.5%,
w/v) were carried out using conventional protocols (Laemmli,
1970 ). IEF was performed in 7.5% (w/v) polyacrylamide gels,
using ampholytes with pI values in the range of 4.45 to 9.60 (Bio-Rad)
according to Jun et al. (1994) .
The kinetics of the reactions and the characterization of enzymes were
performed with a Cary 1-Bio spectrophotometer (Varian, Mulgrave,
Australia) using a 200-µL microcuvette (1.0-cm path length). Final
enzyme concentrations were between 0.2 and 2 µg of rFLbR protein per
assay. Soybean ferric Lb reduction and lipoamide-mediated NADH
oxidation were assayed following the decreases of
A574 (extinction coefficient of 10.2 mM 1 cm 1) and
A340 (extinction coefficient of 6.2 mM 1 cm 1), respectively, as
indicated by Saari and Klucas (1984) and Ji et al. (1994b) ,
respectively. All kinetics measurements were made in a final assay
buffer containing 50 mM potassium phosphate (pH 6.5), 2 mM EDTA, and fixed (500 µM) or variable
(40-500 µM) NADH concentrations. Averages of values from
three experiments are reported. Original data were fitted to the
Michaelis-Menten equation using Sigmaplot software (v3.0; SPSS, Chicago).
Expression of FLbR-2 in Soybean
Total RNA was extracted from nodules using the hot phenol method
followed by LiCl precipitation (de Vries et al., 1982 ). For the RT-PCR
analysis of soybean tissues, total RNA (5 µg) was treated with 2 units of DNase I at 37°C for 10 min to remove traces of contaminating
DNA. After addition of 2.5 mM EDTA, samples were incubated
at 65°C for 15 min to inactivate DNase. For RT, RNA samples were
annealed to the primer 5'-CTCGAGGATCCGCGGCCGC-(T)20-3' at
70°C for 10 min, and then the cDNAs were synthesized using 200 units
of reverse transcriptase (Superscript, Life Technologies) in a reaction
mixture containing 10 mM dithiothreitol, 1.25 mM dNTPs, and buffer (20 mM Tris-HCl [pH
8.4], 50 mM KCl, 2.5 mM MgCl2).
The reaction proceeded at 42°C for 55 min and was stopped at 70°C
for 15 min. The remaining RNA present in the samples was removed by
incubation with 1 unit of RNase H at 37°C for 20 min. The reaction
mixture was diluted to 120 µL, and 5 µL was used as template for
PCR amplification.
For the PCR reactions, two gene-specific primers were
designed based on the flbr-2 sequence. Primers
were 5'-GGTATTGAAGGTCTATTCAAGAAAAAC-3' (forward) and
5'-TATCTTGTCCAACCCAAGTTCGGC-3' (reverse). The reaction mixture
contained 5 µL of first-strand cDNA, 0.25 mM dNTPs, 1.5 mM MgCl2, 0.2 µM of primers, and
1.25 units of Taq polymerase (Life Technologies) in a
total volume of 25 µL. The PCR-cycling conditions comprised an
initial denaturation step at 94°C for 2 min, 30 to 35 cycles at
94°C for 30 s, 60°C for 30 s, and 72°C for 45 s,
and a final elongation step at 72°C for 10 min. As an internal
control, PCR was performed simultaneously with ubiquitin primers
(Horvath et al., 1993 ). As markers of nodule activity, fragments of Lb a (Hyldig-Nielsen et al.,
1982 ) and of constitutive cytosolic Gln synthetase (Miao et al., 1991 ;
Roche et al., 1993 ) from soybean were PCR amplified using specific
primers. Primers for Lb were 5'-CACTGAGAAGCAAGATGCTTTGG-3'
(forward) and 5'-AGCTGCTGCCAATTCATCGTAG-3' (reverse). Primers for
Gln synthetase were 5'-AGCTGGTGATGAGATTTGGGCA-3' (forward) and
5'-AACCACGTATGGGTCCATGTTG-3' (reverse).
Immunolocalization of FLbR-2 in Soybean and Pea Nodules
Isolation of soybean nodule mitochondria, cytosol, and
bacteroids was performed as previously described (Moran et al., 2000 ). Crude extracts were obtained by grinding leaves or nodules of soybean
or pea in 30 mM
3-[N-morpholino]-propanesulfonic acid (pH 7.2), 2 mM EDTA, 2% (w/v) polyvinylpolypyrrolidone, 1 mM phenylmethylsulfonyl fluoride, and 2.5 µg each of
leupeptin and pepstatin. Extracts were filtered through Miracloth
(Calbiochem, San Diego) and cleared by centrifugation, and the
supernatants were desalted using Centricon-30 (Amicon). Proteins were
resolved in 7.5% (w/v) polyacrylamide SDS gels and electroblotted onto
a polyvinylidene difluoride membrane. Immunoblots were carried out
following standard protocols using a 1:2,000 dilution of rabbit
polyclonal antibody raised against pea leaf mitochondria (Turner et
al., 1992 ). The secondary antibody was goat anti-rabbit IgG alkaline
phosphatase conjugate (Sigma, St. Louis) at a dilution of 1:30,000.
Immunoreactive proteins were detected using
5-bromo-4-chloro-3-indolyl-phosphate/nitroblue tetrazolium as the
substrate (Sigma).
For electron microscopy analysis, mature, N2-fixing
soybean and pea nodules were fixed in 4% (w/v) paraformaldehyde and
0.1% (v/v) glutaraldehyde in 50 mM potassium phosphate
buffer (pH 7.0). Slices (200 µm) of four nodules from each species
were obtained with a Vibratome 1000 (Agar Scientific, Stansted, UK),
immersed overnight in 1.8 M Suc, and then frozen rapidly in
liquid N2. The frozen slices were then freeze substituted
in methanol containing 0.5% (w/v) uranyl acetate using an EM AFS
freeze substitution apparatus (Leica, Vienna) at 90, 65, and
45°C over a period of 68.5 h, before being embedded and
polymerized in Lowicryl HM23 (Polysciences, Warrington, PA) at
45°C. Ultrathin sections (80 nm) were cut on an Ultracut E
microtome (Leica) and collected on pioloform/carbon-coated Ni grids.
The sections were then immediately immunogold labeled according to the
procedures of James et al. (1996) . They were first placed for 1 h
on a blocking/diluting buffer containing 1% (v/v) Tween 20 and 1%
(w/v) bovine serum albumin in Tris-buffered saline (10 mM
Tris-HCl [pH 7.5], 150 mM NaCl, 0.5 g
L 1 polyethyleneglycol-20 K, 14 mM
Na3N) and then incubated for 2 h in a 1:100 dilution
(in buffer) of the primary antibody (rabbit anti-pea leaf DLDH). After
the grids were washed, they were incubated in a 1:50 dilution of goat
anti-rabbit antibodies conjugated to 15-nm gold particles (Amersham
Pharmacia Biotech, Piscataway, NJ) for 1 h. The sections
were viewed and photographed using a 1200 EX transmission electron
microscope (JEOL, Tokyo). As a control, serial sections of soybean
nodules were immunogold labeled using a 1:100 dilution of anti-pea leaf
DLDH that had been pre-absorbed for 1 h at room temperature with
various concentrations (40, 400, and 1,600 µg mL 1) of
FLbR-2 protein.
 |
ACKNOWLEDGMENTS |
The authors are most grateful to Dr. Stephen Rawsthorne (John
Innes Centre, Norwich, UK) for his generous gift of DLDH antibody, to
Dr. Iñaki Iturbe-Ormaetxe (University of Queensland,
Brisbane, Australia) for help with RT-PCR analysis, and to Steve Watt
(University of Dundee, Dundee, UK) for help with the freeze
substitution technique.
 |
FOOTNOTES |
Received June 7, 2001; returned for revision August 17, 2001; accepted October 17, 2001.
1
This work was supported by the National Science
Foundation (grant no. OSR-92552255) and the U.S. Department of
Agriculture-Cooperative State Research Education and Extension Service
(grant no. 95-37305-2441). Access to the BioCad workstation was
provided by the Center for Biotechnology at the University of Nebraska,
Lincoln, funded through the Nebraska Research Initiative. J.F.M. was
the recipient of a postdoctoral contract from the Ministry of Education
and Culture (Spain).
2
This is journal paper no. 12,643, Agricultural Research
Division, University of Nebraska.
*
Corresponding author; e-mail jmoran{at}eead.csic.es; fax
34-976-716145.
Article, publication date, and citation information can be found at
www.plantphysiol.org/cgi/doi/10.1104/pp.010505.
 |
LITERATURE CITED |
-
Altschul SF, Madden TL, Schaffer AA, Zhang J, Zhang Z, Miller W, Lipman DJ
(1997)
Gapped BLAST and PSI-BLAST: a new generation of protein database search programs.
Nucleic Acids Res
25: 3389-3402[Abstract/Free Full Text]
-
Appleby CA
(1984)
Leghemoglobin and Rhizobium respiration.
Annu Rev Plant Physiol
35: 443-478[CrossRef][Web of Science]
-
Arredondo-Peter R, Moran JF, Sarath G, Luan P, Klucas RV
(1997)
Molecular cloning of the cowpea leghemoglobin II gene and expression of its cDNA in Escherichia coli.
Plant Physiol
114: 493-500[Abstract]
-
Becana M, Klucas RV
(1990)
Enzymatic and nonenzymatic mechanisms for ferric leghemoglobin reduction in legume root nodules.
Proc Natl Acad Sci USA
87: 7295-7299[Abstract/Free Full Text]
-
Becana M, Klucas RV
(1992)
Oxidation and reduction of leghemoglobin in root nodules of leguminous plants.
Plant Physiol
98: 1217-1221[Abstract/Free Full Text]
-
Bourguignon L, Merand V, Rawsthorne S, Forest E, Douce R
(1996)
Glycine decarboxylase and pyruvate dehydrogenase complexes share the same dihydrolipoamide dehydrogenase in pea leaf mitochondria: evidence from mass spectrometry and primary-structure analysis.
Biochem J
313: 229-234
-
Claros MG
(1995)
MitoProt, a Macintosh application for studying mitochondrial proteins.
Comput Appl Biosci
11: 441-447[Abstract/Free Full Text]
-
Conner M, Krell T, Lindsay JG
(1996)
Identification and purification of a distinct dihydrolipoamide dehydrogenase from pea chloroplasts.
Planta
200: 195-202[Web of Science][Medline]
-
Dalton DA, Joyner SL, Becana M, Iturbe-Ormaetxe I, Chatfield JM
(1998)
Antioxidant defenses in the peripheral cell layers of legume root nodules.
Plant Physiol
116: 37-43[Abstract/Free Full Text]
-
de Vries SC, Springer J, Wessels JHG
(1982)
Diversity of abundant messenger-RNA sequences and patterns of protein synthesis in etiolated and greened pea seedlings.
Planta
156: 129-135[CrossRef]
-
Gavel Y, von Heijne G
(1990)
Cleavage-site motifs in mitochondrial targeting peptides.
Protein Eng
4: 33-37[Abstract/Free Full Text]
-
Horvath B, Heidstra R, Lados M, Moerman M, Spaink HP, Promé JC, van Kammen A, Bisseling T
(1993)
Lipo-oligosaccharides of Rhizobium induce infection-related early nodulin gene expression in pea root hairs.
Plant J
4: 727-733[CrossRef][Web of Science][Medline]
-
Hyldig-Nielsen JJ, Jensen E, Paludan K, Wiborg O, Garrett R, Joergensen PL, Marcker KA
(1982)
The primary structure of two primary leghemoglobin genes from soybean.
Nucleic Acids Res
10: 689-701[Abstract/Free Full Text]
-
James EK, Iannetta PPM, Nixon PJ, Whiston AJ, Peat L, Crawford RMM, Sprent JI, Brewin NJ
(1996)
Photosystem II and oxygen regulation in Sesbania rostrata stem nodules.
Plant Cell Environ
19: 895-910[CrossRef]
-
Ji L, Becana M, Sarath G, Klucas RV
(1994a)
Cloning and sequence analysis of a cDNA encoding ferric leghemoglobin reductase from soybean nodules.
Plant Physiol
104: 453-459[Abstract]
-
Ji L, Becana M, Sarath G, Shearman L, Klucas RV
(1994b)
Overproduction in Escherichia coli and characterization of a soybean ferric leghemoglobin reductase.
Plant Physiol
106: 203-209[Abstract]
-
Ji L, Wood S, Becana M, Klucas RV
(1991)
Purification and characterization of soybean root nodule ferric leghemoglobin reductase.
Plant Physiol
96: 32-37[Abstract/Free Full Text]
-
Jun H, Sarath G, Wagner RW
(1994)
Detection and purification of modified leghemoglobins from soybean root nodules.
Plant Sci
100: 31-40
-
Kim HM
(1996)
Approaches to a reaction mechanism for soybean ferric leghemoglobin reductase. PhD thesis. University of Nebraska, Lincoln
-
King BJ, Hunt S, Weagle GE, Walsh KB, Pottier RH, Canvin DT, Layzell DB
(1988)
Regulation of O2 concentration in soybean nodules observed by in situ spectroscopic measurement of leghemoglobin oxygenation.
Plant Physiol
87: 296-299[Abstract/Free Full Text]
-
Laemmli UK
(1970)
Cleavage of structural proteins during the assembly of the head of bacteriophage T4.
Nature
227: 680-685[CrossRef][Medline]
-
Lee KK, Klucas RV
(1984)
Reduction of ferric leghemoglobin in soybean root nodules.
Plant Physiol
74: 984-988[Abstract/Free Full Text]
-
Lee KK, Shearman LL, Erickson BK, Klucas RV
(1995)
Ferric leghemoglobin in plant-attached leguminous nodules.
Plant Physiol
109: 261-267[Abstract]
-
Luan P, Aréchaga-Ocampo E, Sarath G, Arredondo-Peter R, Klucas RV
(2000)
Analysis of a ferric leghemoglobin reductase from cowpea (Vigna unguiculata) root nodules.
Plant Sci
154: 161-170[Medline]
-
Miao GH, Hirel B, Marsolier MC, Ridge RW, Verma DP
(1991)
Ammonia-regulated expression of a soybean gene encoding cytosolic glutamine synthetase in transgenic Lotus corniculatus.
Plant Cell
3: 11-22[Abstract/Free Full Text]
-
Millar AH, Day DA, Bergersen FJ
(1995)
Microaerobic respiration and oxidative phosphorylation by soybean nodule mitochondria: implications for nitrogen fixation.
Plant Cell Environ
18: 715-726
-
Monroe JD, Owens TG, LaRue TA
(1989)
Measurement of the fractional oxygenation of leghemoglobin in intact detached pea nodules by reflectance spectroscopy.
Plant Physiol
91: 598-602[Abstract/Free Full Text]
-
Moran JF, Iturbe-Ormaetxe I, Matamoros MA, Rubio MC, Clemente MR, Brewin NJ, Becana M
(2000)
Glutathione and homoglutathione synthetases of legume nodules: cloning, expression, and subcellular localization.
Plant Physiol
124: 1381-1392[Abstract/Free Full Text]
-
Nakai K, Kanehisa M
(1992)
A knowledge base for predicting protein localization sites in eukaryotic cells.
Genomics
14: 897-911[CrossRef][Web of Science][Medline]
-
Neuburger M, Polidori A, Piètre E, Faure M, Jourdain A, Bourguignon J, Pucci B, Douce R
(2000)
Interaction between the lipoamide-containing H-protein and the lipoamide dehydrogenase (L-protein) of the glycine decarboxylase multienzyme system: 1. Biochemical studies.
Eur J Biochem
267: 2882-2889[Web of Science][Medline]
-
Pullikuth AK, Gill SS
(1997)
Primary structure of an invertebrate dihydrolipoamide dehydrogenase with phylogenetic relationship to vertebrate and bacterial disulfide oxidoreductases.
Gene
200: 163-172[Medline]
-
Rawsthorne S, Douce R, Oliver D
(1995)
The glycine decarboxylase complex in higher plant mitochondria: structure, function and biogenesis.
In
RM Wallsgrove, ed, Amino Acids and their Derivatives in Higher Plants. Cambridge University Press, Cambridge, UK, pp 87-109
-
Roche D, Temple SJ, Sengupta-Gopalan C
(1993)
Two classes of differentially regulated glutamine synthetase genes are expressed in the soybean nodule: a nodule-specific class and a constitutively expressed class.
Plant Mol Biol
22: 971-983[Medline]
-
Saari LL, Klucas RV
(1984)
Ferric leghemoglobin reductase from soybean root nodules.
Arch Biochem Biophys
231: 102-113[Medline]
-
Sanger F, Nicklen S, Coulson AR
(1977)
DNA sequencing with chain terminating inhibitors.
Proc Natl Acad Sci USA
74: 5463-5467[Abstract/Free Full Text]
-
Sarath G, Wagner FW
(1989)
Immunological detection of nitrogenase.
In
HF Linskens, JF Jackson, eds, Modern Methods of Plant Analysis. Springer-Verlag, Berlin, pp 227-239
-
Turner SR, Ireland R, Rawsthorne S
(1992)
Purification and primary amino acid sequence of the L subunit of glycine decarboxylase.
J Biol Chem
267: 7745-7750[Abstract/Free Full Text]
-
von Heijne G, Steppuhn J, Herrmann RG
(1989)
Domain structure of mitochondrial and chloroplast targeting peptides.
Eur J Biochem
180: 535-545[Web of Science][Medline]
-
Williams CH Jr
(1991)
Lipoamide dehydrogenase, glutathione reductase, thioredoxin reductase and mercuric ion reductase: family of flavoenzyme transhydrogenases.
In
F Muller, ed, Chemistry and Biochemistry of Flavoenzymes, Ed 1, Vol. 3. CRC Press, Boca Raton, FL, pp 121-212
© 2002 American Society of Plant Physiologists
This article has been cited by other articles:

|
 |

|
 |
 
K. Mitra, N. Rangaraj, and S. Shivaji
Novelty of the Pyruvate Metabolic Enzyme Dihydrolipoamide Dehydrogenase in Spermatozoa: CORRELATION OF ITS LOCALIZATION, TYROSINE PHOSPHORYLATION, AND ACTIVITY DURING SPERM CAPACITATION
J. Biol. Chem.,
July 8, 2005;
280(27):
25743 - 25753.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
A. U. Igamberdiev and R. D. Hill
Nitrate, NO and haemoglobin in plant adaptation to hypoxia: an alternative to classic fermentation pathways
J. Exp. Bot.,
December 1, 2004;
55(408):
2473 - 2482.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
R M Fleming
What Effect, if any, does Soy Protein have on Breast Tissue?
Integr Cancer Ther,
September 1, 2003;
2(3):
225 - 228.
[Abstract]
[PDF]
|
 |
|

|
 |

|
 |
 
H. Bauwe and U. Kolukisaoglu
Genetic manipulation of glycine decarboxylation
J. Exp. Bot.,
June 1, 2003;
54(387):
1523 - 1535.
[Abstract]
[Full Text]
[PDF]
|
 |
|
|
|