Table I.

Confirmed GPI-anchored proteins from Arabidopsis callus

Proteins were separated by two-dimensional difference gel electrophoresis (A, pH 3-10; B, pH 4-7) or one-dimensional SDS-PAGE (C, 12% [w/v] gel; D, 16% [w/v] gel). Proteins sensitive to Pi-PLC were identified by LC-MS/MS. Letters indicate experiments that yielded identification of a protein. Uppercase letters indicate identifications with greater than 95% confidence based on MASCOT scores (see “Materials and Methods”). The most likely cleavage sites (Udenfriend and Kodukula, 1995) are indicated (bold). The hydrophobic domain of each C-terminal signal peptide is underlined. Confirmations have been submitted to the Munich Information Center for Protein Sequences (MIPS).

No. Protein Family MIPS No. Identifications C Terminus with Predicted Cleavage Site
1 Stellacyanin like At5g20230 C, D TTPAGN AASSLGGATFLVAFVSAVVALF
2 Uclacyanin II At2g44790 C, D PPPKAS GASKGVMSYVLVGVSMVLGYGLWM
3 Early nodulin like 1 At2g25060 C APAPIS GSVRLGGCYVVLGLVLGLCAWF
4 Early nodulin like 2 At4g27520 D PGQKKS SANGMTVMSITTVLSLVLTIFLSA
5 Early nodulin like 3 At5g25090 C ASGGSA SSLTRQVGVLGFVGLLAIVLL
6 COBRA like 7 (COBL7) At4g16120 A, B, C, D ILPMRS SQHRKHISVFLLALPVLALLILRA
7 glycerophosphodiesterase-like 2 (GPDL2) At4g26690 A, C, D TPSTNA QAPSGQTRITLSLLLSVFAMVLASLLLL
8 glycerophosphodiesterase-like 1 (GPDL1) At5g55480 A, B, C, D TPGPQS TGEKSPNGQTRVALSLLLSAFATVFASLLLL
9 Hedgehog interacting protein like 1 (HIPL1) At1g74790 A, B, C, D SPSSSS SSCYKHINGFHGSLVVLFVSLSLILLGLLN
10 Hedgehog interacting protein like 2 (HIPL2) At5g62630 C PQPLPS SARKLCFSVFLLLSLLMMFLTLLD
11 FLA7 At2g04780 D KSSHKN SGQKLLLAPISMVISGLVALFL
12 FLA8 At2g45470 C, D NSKSAN AAVGVSTPSLFTALVTIAAIAVSVSLCS
13 FLA10 At3g60900 C, D NSNAKN AAFHVNAPALFTALVTIAATSLLL
14 FLA1 At5g55730 C, D DATADD AGAVRIIGGAKAGLVVSLLCLFASSWLL
15 β-1,3 Glucanase 1 At1g11830 A NSTEVA AGEATSRSLSRGFCVTIMILVTFSIL
16 β-1,3 Glucanase 2 At1g66250 A, C, D ANSTTS SGIRSDLYYSRGIWSILTVMILNVANIL
17 β-1,3 Glucanase 3 At2g01630 A, c, D ANSTTS GCIPKYYHHPHASFGDLTLLSLLLIIALVFL
18 β-1,3 Glucanase 4 At3g13560 C PLGGNA NARIIFSYHLPILAPLALTLLQLLLQHDRLL
19 β-1,3 Glucanase 5 At4g31140 A, D EDASEA SAMMPITRSTAVLLLLSICLYIVL
20 β-1,3 Glucanase 6 At5g58090 D EPYYGG AAREHGFFFPLLMVAAIAVSIF
21 Lipid transfer protein like (LTPL) At1g27950 c, D DKGGSA SAKDGHAVVALAVALMAVSFVLTLPRHVTLGM
22 SKU5 At4g12420 B, C, D QKVSSS ASKSIGFTSLSMVVMALVMMMMLQH
23 SKU5 homolog (SKS1) At4g25240 A, D KEQHHS AATSILNGHLKLMLLMVLLASVFRFC
24 Receptor like (Duf26) 1 At5g41280 a, b, D PPPSRS GSFSIRGNNKILVGMILAVSVFAFLGL
25 Receptor like (Duf26) 2 At5g41290 A, B, D PPPSRS GSFSHRGNNKLLGGMVLAVSVSVFAFLSLV
26 Receptor like (lysM) 1 At1g21880 D GSISTA SASSVSYFFITFLISIASFSLALSS
27 Receptor like (lysM) 2 At2g17120 A, B, D SPACPD SAGPDNYASTLSSSFNFVIVLIQCALLCLCLL
28 Auxin-induced protein AIR12 At3g07390 C, D AGGPGN AGSLTRNVNFGVNLGILVLLGSIFIF
29 Unknown protein At5g19230 C LTTTNS GAYAFGVNGLVSSSFLFLLFCFFMF
30 Unknown protein At5g19250 ca SPASNS GAFAFGVNGLVSSSLMFLLFCFFMF
  • a Sequenced manually from MS/MS spectra to confirm identification.